(data stored in ACNUC7421 zone)

EMBL: CP001854.PE13

CP001854.PE13        Location/Qualifiers
FT   CDS             16003..16515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0013"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: scl:sce7616 adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48449"
FT                   /db_xref="GOA:D3EYP5"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP5"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48449.1"
FT                   /translation="MTLEPASVALKLGFLAVLYLFLLWIVRSSLKDLRRAQAGGDAAVA
FT                   EMHAAAPAADATAMHNAADDLLGDAIGDGEPRLVVERAAGHPDGIAYDLARGVTLGRGD
FT                   VEIRLEDPFASSHHARIERQGSVLVLEDLGSTNGTYLNEEPLRGIQPLHHGDRIRIGDS
FT                   EFSYLQD"
     MTLEPASVAL KLGFLAVLYL FLLWIVRSSL KDLRRAQAGG DAAVAEMHAA APAADATAMH        60
     NAADDLLGDA IGDGEPRLVV ERAAGHPDGI AYDLARGVTL GRGDVEIRLE DPFASSHHAR       120
     IERQGSVLVL EDLGSTNGTY LNEEPLRGIQ PLHHGDRIRI GDSEFSYLQD                  170
//

If you have problems or comments...

PBIL Back to PBIL home page