(data stored in ACNUC7421 zone)

EMBL: CP001854.PE130

CP001854.PE130       Location/Qualifiers
FT   CDS             131473..133101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0130"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: mes:Meso_0074 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48566"
FT                   /db_xref="GOA:D3F4Y8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ADB48566.1"
FT                   /translation="MRDLRPSRRELLQGGGAAVGLLGLGGVLSACGGGESTSRAGSSQA
FT                   AATGERGGEITWGLAADPVFMVPFGATLGATREATEPIYESLLTWDRDLRIVPALAASY
FT                   SSPDDTTYEFVLRDGARFHDGRPVRASDVVYSIGLQRRPPPPGTPDMAVHVPAIKDVVA
FT                   VDERTVRISMDGPDARLPGFLAWGRHSSIVPEGMYDDIDPRTEANGTGPFRLVGYKQND
FT                   RVTFEANRDYWQSSMPGVDRMTLRVMTDEQGRLAALRAGDIDGCSVSPDLSEVLAADPN
FT                   VEVLKGLVAAHRELQFTIKTGERKPWHDKRVRQAINHAIDRQDLIERVYAGSAEFSGVV
FT                   PPGYGDWPLADEELRSDLLAHDPERARALLAAAGFGDGFTIELEVASTTTDLVKTAEIL
FT                   QQQLADVGVELKIRPIELAAFAKNNGEGRFDLHLTYRGMRGDVAGYVSDFDPSQPLYRD
FT                   VWFPGATDVDPELGRLIRQGATTIAEADRRPIYEQVQRLALAEALHVPLCNPYKFQAVS
FT                   KRVSGMYVAYTDFNPGLATARVTAS"
     MRDLRPSRRE LLQGGGAAVG LLGLGGVLSA CGGGESTSRA GSSQAAATGE RGGEITWGLA        60
     ADPVFMVPFG ATLGATREAT EPIYESLLTW DRDLRIVPAL AASYSSPDDT TYEFVLRDGA       120
     RFHDGRPVRA SDVVYSIGLQ RRPPPPGTPD MAVHVPAIKD VVAVDERTVR ISMDGPDARL       180
     PGFLAWGRHS SIVPEGMYDD IDPRTEANGT GPFRLVGYKQ NDRVTFEANR DYWQSSMPGV       240
     DRMTLRVMTD EQGRLAALRA GDIDGCSVSP DLSEVLAADP NVEVLKGLVA AHRELQFTIK       300
     TGERKPWHDK RVRQAINHAI DRQDLIERVY AGSAEFSGVV PPGYGDWPLA DEELRSDLLA       360
     HDPERARALL AAAGFGDGFT IELEVASTTT DLVKTAEILQ QQLADVGVEL KIRPIELAAF       420
     AKNNGEGRFD LHLTYRGMRG DVAGYVSDFD PSQPLYRDVW FPGATDVDPE LGRLIRQGAT       480
     TIAEADRRPI YEQVQRLALA EALHVPLCNP YKFQAVSKRV SGMYVAYTDF NPGLATARVT       540
     AS                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page