(data stored in ACNUC7421 zone)

EMBL: CP001854.PE131

CP001854.PE131       Location/Qualifiers
FT   CDS             133103..134053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0131"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbt:BBta_2849 ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48567"
FT                   /db_xref="GOA:D3F4Y9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Y9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48567.1"
FT                   /translation="MARYLASRVAQLGLTLLGVSVVIFLLVRLLPGDVLDASSGDTVAG
FT                   SSEGRDALREALGLADPLPVQYFDWIKGLVTGDLGVSLRSGEPLANLLSTALPMTLEIV
FT                   LLGVAIALLVGIPLGVLSAVRSGRAIDYVGRAIGMIGVSLPSFWLATLMLLVTSSAFGW
FT                   VPSSTYISPFEDPLGNLAALILPALCISVYMLALVMRMVRATMLEVLGEDYVRTARAKG
FT                   AAPRTVVVRHALRNALLPVITVSAFEVGVLLASTALIEVVFGLPGLGNLLVQGIFNRDY
FT                   AVIQTVTLLLAATFVLMNLIADVLYALVDPRVELR"
     MARYLASRVA QLGLTLLGVS VVIFLLVRLL PGDVLDASSG DTVAGSSEGR DALREALGLA        60
     DPLPVQYFDW IKGLVTGDLG VSLRSGEPLA NLLSTALPMT LEIVLLGVAI ALLVGIPLGV       120
     LSAVRSGRAI DYVGRAIGMI GVSLPSFWLA TLMLLVTSSA FGWVPSSTYI SPFEDPLGNL       180
     AALILPALCI SVYMLALVMR MVRATMLEVL GEDYVRTARA KGAAPRTVVV RHALRNALLP       240
     VITVSAFEVG VLLASTALIE VVFGLPGLGN LLVQGIFNRD YAVIQTVTLL LAATFVLMNL       300
     IADVLYALVD PRVELR                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page