(data stored in ACNUC7421 zone)

EMBL: CP001854.PE132

CP001854.PE132       Location/Qualifiers
FT   CDS             134050..134952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0132"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bbr:BB2519 ABC transporter
FT                   inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48568"
FT                   /db_xref="GOA:D3F4Z0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48568.1"
FT                   /translation="MSAPATVATAAEVEVGATGASARRRVRLSPMLRTPIAIAGLSIVL
FT                   LTVFVAVAGPWIWTTDPYAADAARLQPPSWAHPMGTDELGRDTLARVIYGARVSLEVGL
FT                   SAVGVAALLGSLIGLVAAFYGRWVDTALMRFVDVLFALPALVLAIVVAGLLGPSRTNAM
FT                   LAIGIAYAPAFARVVRSAALSVMTQPYIEAARALGTSSATTIRRHLLPNVMAPLVVMAS
FT                   TYLGTAILAEASLSFLGLGTQPPQPSWGGMLSSARTYMLVSPWVAIFPGLAIMVVVLGV
FT                   NLLGDALRDGLDPKLRGRR"
     MSAPATVATA AEVEVGATGA SARRRVRLSP MLRTPIAIAG LSIVLLTVFV AVAGPWIWTT        60
     DPYAADAARL QPPSWAHPMG TDELGRDTLA RVIYGARVSL EVGLSAVGVA ALLGSLIGLV       120
     AAFYGRWVDT ALMRFVDVLF ALPALVLAIV VAGLLGPSRT NAMLAIGIAY APAFARVVRS       180
     AALSVMTQPY IEAARALGTS SATTIRRHLL PNVMAPLVVM ASTYLGTAIL AEASLSFLGL       240
     GTQPPQPSWG GMLSSARTYM LVSPWVAIFP GLAIMVVVLG VNLLGDALRD GLDPKLRGRR       300
//

If you have problems or comments...

PBIL Back to PBIL home page