(data stored in ACNUC7421 zone)

EMBL: CP001854.PE133

CP001854.PE133       Location/Qualifiers
FT   CDS             134949..135935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0133"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: dde:Dde_1182 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein-like; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48569"
FT                   /db_xref="GOA:D3F4Z1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48569.1"
FT                   /translation="MTDGTLLTVERLDVRFRTAGGWTQVVDGVDLTVGAGETLCVVGES
FT                   GSGKSVTALALMGLLDAGAARVEGRIDFGGRDLAALSERDWQRVRGNDVAMIFQEPMSS
FT                   LNPVLRIGDQIAESVLLHSDADKAAADRRAVELLRLVGIPAPERRARDYPHQLSGGMRQ
FT                   RVMIAIALSCSPRLLIADEPTTALDVTIQAQILELIGELRERLEMAVLLITHDLGVVAE
FT                   TADRVAVMYAGKIVEQGDVKAVFEDPQHPYTAALLRAIPVLGSTYAEPLYAIPGTVPSP
FT                   GGWPDGCRFAARCEHVHAACAQDPPAFARGSHFARCWLRDPDAEERR"
     MTDGTLLTVE RLDVRFRTAG GWTQVVDGVD LTVGAGETLC VVGESGSGKS VTALALMGLL        60
     DAGAARVEGR IDFGGRDLAA LSERDWQRVR GNDVAMIFQE PMSSLNPVLR IGDQIAESVL       120
     LHSDADKAAA DRRAVELLRL VGIPAPERRA RDYPHQLSGG MRQRVMIAIA LSCSPRLLIA       180
     DEPTTALDVT IQAQILELIG ELRERLEMAV LLITHDLGVV AETADRVAVM YAGKIVEQGD       240
     VKAVFEDPQH PYTAALLRAI PVLGSTYAEP LYAIPGTVPS PGGWPDGCRF AARCEHVHAA       300
     CAQDPPAFAR GSHFARCWLR DPDAEERR                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page