(data stored in ACNUC7421 zone)

EMBL: CP001854.PE134

CP001854.PE134       Location/Qualifiers
FT   CDS             135932..136939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0134"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bja:blr1357 peptide ABC transporter ATP-
FT                   binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48570"
FT                   /db_xref="GOA:D3F4Z2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ADB48570.1"
FT                   /translation="MSDVLVRARDLRVHFPLGGGVLSRSSAQVRAVDGVELEIRRGETL
FT                   GLVGESGCGKSTLGRALVRLVRPTGGSVEFDGTDVARLPRRGRGRGDGSGRDGRGALAR
FT                   EMQIVFQDPVGSLNPRMKVGAIVAEGLASNRIGTRASRRELVVEMLERVGLGSDAVDRY
FT                   PHEFSGGQRQRIVIARALAVGARFVVADEPVSALDVSVQSQVLNLFVRLKRELDLTYVF
FT                   VAHDLAVVGYVSDRIAVMYLGKIVELGPAQALISAPRHPYTRALLSAVPQARVGARRER
FT                   TALTGDVPNPIDPPSGCRFRTRCPMAAAICAEQEPPLRTHGDGHLAACHFAEAV"
     MSDVLVRARD LRVHFPLGGG VLSRSSAQVR AVDGVELEIR RGETLGLVGE SGCGKSTLGR        60
     ALVRLVRPTG GSVEFDGTDV ARLPRRGRGR GDGSGRDGRG ALAREMQIVF QDPVGSLNPR       120
     MKVGAIVAEG LASNRIGTRA SRRELVVEML ERVGLGSDAV DRYPHEFSGG QRQRIVIARA       180
     LAVGARFVVA DEPVSALDVS VQSQVLNLFV RLKRELDLTY VFVAHDLAVV GYVSDRIAVM       240
     YLGKIVELGP AQALISAPRH PYTRALLSAV PQARVGARRE RTALTGDVPN PIDPPSGCRF       300
     RTRCPMAAAI CAEQEPPLRT HGDGHLAACH FAEAV                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page