(data stored in ACNUC7421 zone)

EMBL: CP001854.PE135

CP001854.PE135       Location/Qualifiers
FT   CDS             complement(136944..137564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0135"
FT                   /product="protein-L-isoaspartate O-methyltransferase"
FT                   /EC_number="2.1.1.77"
FT                   /note="KEGG: asa:ASA_3469 protein-L-isoaspartate O-
FT                   methyltransferase; TIGRFAM: protein-L-isoaspartate O-
FT                   methyltransferase; PFAM:
FT                   protein-L-isoaspartate(D-aspartate) O- methyltransferase;
FT                   Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48571"
FT                   /db_xref="GOA:D3F4Z3"
FT                   /db_xref="InterPro:IPR000682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z3"
FT                   /inference="protein motif:TFAM:TIGR00080"
FT                   /protein_id="ADB48571.1"
FT                   /translation="MDPAAELARSLRSVVADARVLAAIAAVPRELFVPEALRERAYDNV
FT                   ALPIGQGQTISQPLVVARMLEVLDLGPDDDVLDVGTGSGYHAALLARLVRHVWTIERHR
FT                   RLSAAAEGNLRAAGVENVTVLVGDGSRGLDEQAPFDAINVAAAAWPQVPAALERQLARG
FT                   GRLVAPVGASGQQLVLVERGADGELRRTALEAVRFVPLIEGEP"
     MDPAAELARS LRSVVADARV LAAIAAVPRE LFVPEALRER AYDNVALPIG QGQTISQPLV        60
     VARMLEVLDL GPDDDVLDVG TGSGYHAALL ARLVRHVWTI ERHRRLSAAA EGNLRAAGVE       120
     NVTVLVGDGS RGLDEQAPFD AINVAAAAWP QVPAALERQL ARGGRLVAPV GASGQQLVLV       180
     ERGADGELRR TALEAVRFVP LIEGEP                                            206
//

If you have problems or comments...

PBIL Back to PBIL home page