(data stored in ACNUC7421 zone)

EMBL: CP001854.PE136

CP001854.PE136       Location/Qualifiers
FT   CDS             137611..138561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0136"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   pol:Bpro_1976 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48572"
FT                   /db_xref="GOA:D3F4Z4"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z4"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADB48572.1"
FT                   /translation="MSGVPPNIVRRRVMALLVLVAALAVVVALVVTVAGGGDDDPASAR
FT                   ADAGAAAKTTGARARGDGGRAGGGSAAGAAASPTAGRDMGRPGPPRPVPILMYHVTTDP
FT                   PANAPFPDLYVRASEFADQMQALKQAGYVAVTQQELWDAWHRGGPLPARAVVVSIDDGY
FT                   RSNYLNARPVLRRLGWPAVLNLKVGNLSEPEYGLTDGQVKELIADGWEIDSHTIDHPDL
FT                   TTVDAATLAREVAESRAELQRRFGVPVNFFCYPAGRYDDTVIAAVERAGYLAATTVEPG
FT                   LAQPDAGSPFALNRVRVNSGVSGASLVSQLADLGA"
     MSGVPPNIVR RRVMALLVLV AALAVVVALV VTVAGGGDDD PASARADAGA AAKTTGARAR        60
     GDGGRAGGGS AAGAAASPTA GRDMGRPGPP RPVPILMYHV TTDPPANAPF PDLYVRASEF       120
     ADQMQALKQA GYVAVTQQEL WDAWHRGGPL PARAVVVSID DGYRSNYLNA RPVLRRLGWP       180
     AVLNLKVGNL SEPEYGLTDG QVKELIADGW EIDSHTIDHP DLTTVDAATL AREVAESRAE       240
     LQRRFGVPVN FFCYPAGRYD DTVIAAVERA GYLAATTVEP GLAQPDAGSP FALNRVRVNS       300
     GVSGASLVSQ LADLGA                                                       316
//

If you have problems or comments...

PBIL Back to PBIL home page