(data stored in ACNUC7421 zone)

EMBL: CP001854.PE137

CP001854.PE137       Location/Qualifiers
FT   CDS             complement(138565..140856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0137"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: har:HEAR0629 putative signal peptide; TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; PAC
FT                   repeat-containing protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48573"
FT                   /db_xref="GOA:D3F4Z5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ADB48573.1"
FT                   /translation="MASSAPVAGGHARDAVRRALAWFPSGRSLPDAVWERRHRGLLILL
FT                   WAHVPALFVFALATGNPLQHALLEVVPIALCALVGQREQLGRRGRAAAVTIGLLTCSAV
FT                   LVHLWDGTIEAHFHYFVMVVALAAYEEWFPYLLAFGYVVLQHGLMGMMEPDSVYAHGTD
FT                   DDRSPWFWAAIHGGFIAALGFASMVTWRANESVRAHLAASEQRFHRAFDDAPIGMALIG
FT                   LDGRFREVNRSLASLTGYGAGKLVQLRLWDLSPADVRAEDHAAWPPSAGMEAVEQRFQR
FT                   ADGTIGWGLWRYSLVQDESGIASHWVVQLLDVTSRKQFEQQLAHQAHHDPLTGLPNRAL
FT                   LTKRLQEALDLAREHDSGVAVIFVDLDNFKVINDSLGHDAGDRLLRNVSERLRRVLRPE
FT                   DLLARFGGDELAVCLERVADTEPANRIADRMATALRAPFVLDGEQRFVTASFGIALARP
FT                   EDPDRSPDTLLRDADAAMYRAKERGKARTEIFDASMRRRAVDRLELESGLREALARNQL
FT                   RVVYQPEVSLESGRIVAVEALLRWEHPQHGPISPARFIPIAEQSGLIVPIGAWVLREAC
FT                   RQAAHWNAESGGDGVVVAVNLSVRQLGASDLEATVRGAIDGARLPADRLCLEITESAVM
FT                   ADPAAAIESLQTLKRVGVKLAIDDFGVGYSSLSHLRELLPIDVLKIDRSFIDGVVLREE
FT                   DRAIVTAIVQLARSLGVDAVAEGVETSDQAAALRAMHCPIAQGFHFARPQPPADVAQLL
FT                   GVHALGELLG"
     MASSAPVAGG HARDAVRRAL AWFPSGRSLP DAVWERRHRG LLILLWAHVP ALFVFALATG        60
     NPLQHALLEV VPIALCALVG QREQLGRRGR AAAVTIGLLT CSAVLVHLWD GTIEAHFHYF       120
     VMVVALAAYE EWFPYLLAFG YVVLQHGLMG MMEPDSVYAH GTDDDRSPWF WAAIHGGFIA       180
     ALGFASMVTW RANESVRAHL AASEQRFHRA FDDAPIGMAL IGLDGRFREV NRSLASLTGY       240
     GAGKLVQLRL WDLSPADVRA EDHAAWPPSA GMEAVEQRFQ RADGTIGWGL WRYSLVQDES       300
     GIASHWVVQL LDVTSRKQFE QQLAHQAHHD PLTGLPNRAL LTKRLQEALD LAREHDSGVA       360
     VIFVDLDNFK VINDSLGHDA GDRLLRNVSE RLRRVLRPED LLARFGGDEL AVCLERVADT       420
     EPANRIADRM ATALRAPFVL DGEQRFVTAS FGIALARPED PDRSPDTLLR DADAAMYRAK       480
     ERGKARTEIF DASMRRRAVD RLELESGLRE ALARNQLRVV YQPEVSLESG RIVAVEALLR       540
     WEHPQHGPIS PARFIPIAEQ SGLIVPIGAW VLREACRQAA HWNAESGGDG VVVAVNLSVR       600
     QLGASDLEAT VRGAIDGARL PADRLCLEIT ESAVMADPAA AIESLQTLKR VGVKLAIDDF       660
     GVGYSSLSHL RELLPIDVLK IDRSFIDGVV LREEDRAIVT AIVQLARSLG VDAVAEGVET       720
     SDQAAALRAM HCPIAQGFHF ARPQPPADVA QLLGVHALGE LLG                         763
//

If you have problems or comments...

PBIL Back to PBIL home page