(data stored in ACNUC7421 zone)

EMBL: CP001854.PE138

CP001854.PE138       Location/Qualifiers
FT   CDS             complement(140919..141272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48574"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z6"
FT                   /inference="similar to AA sequence:KEGG:MXAN_6481"
FT                   /protein_id="ADB48574.1"
FT                   /translation="MPIRRLFGPFFVVAGILHFVKPRIYEAIMPDWLPAHRELVYASGV
FT                   AEIAAGAALLHPRTRRLGGLLSVATLVAVFPANVHMCLHAERYRLPGGRAGLIARLPLQ
FT                   GLLIAWARAAARG"
     MPIRRLFGPF FVVAGILHFV KPRIYEAIMP DWLPAHRELV YASGVAEIAA GAALLHPRTR        60
     RLGGLLSVAT LVAVFPANVH MCLHAERYRL PGGRAGLIAR LPLQGLLIAW ARAAARG          117
//

If you have problems or comments...

PBIL Back to PBIL home page