(data stored in ACNUC7421 zone)

EMBL: CP001854.PE139

CP001854.PE139       Location/Qualifiers
FT   CDS             complement(141282..142463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0139"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_6210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48575"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48575.1"
FT                   /translation="MAARSRRGTRLEPVAELTWDQVLGLRLQRQRLDVRAPHAERLVVA
FT                   GALCGLHAQLMSSAELTLWARVEQLRSDDVATALWEERALVKTWAARGTLHLLPSADYG
FT                   SWTGALTARAPRAYLNASRLRYFGLTEEELLRIAAEIDATLADGRLLTRTELAAEVQRR
FT                   TGSQALGDRLRDNWGSTLKYPAAVGALCFGPSDGQNVRFAHPAAWLGAWRADDGEAALA
FT                   DAARRWLAVAGPLTREELARWWGVAPADGRRMLRLLGDEVVPVTVEGTERWLLAADVEP
FT                   AQRSAAKGSGGVRLLPGFDQYTIAATLHADQLLPAGARARVYRPQGWISPVLLVEGRMA
FT                   GVWRHERRGTALRVGIEPFGRLPRAARAAAASEVELLARFLGGEAALDWGPLG"
     MAARSRRGTR LEPVAELTWD QVLGLRLQRQ RLDVRAPHAE RLVVAGALCG LHAQLMSSAE        60
     LTLWARVEQL RSDDVATALW EERALVKTWA ARGTLHLLPS ADYGSWTGAL TARAPRAYLN       120
     ASRLRYFGLT EEELLRIAAE IDATLADGRL LTRTELAAEV QRRTGSQALG DRLRDNWGST       180
     LKYPAAVGAL CFGPSDGQNV RFAHPAAWLG AWRADDGEAA LADAARRWLA VAGPLTREEL       240
     ARWWGVAPAD GRRMLRLLGD EVVPVTVEGT ERWLLAADVE PAQRSAAKGS GGVRLLPGFD       300
     QYTIAATLHA DQLLPAGARA RVYRPQGWIS PVLLVEGRMA GVWRHERRGT ALRVGIEPFG       360
     RLPRAARAAA ASEVELLARF LGGEAALDWG PLG                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page