(data stored in ACNUC7421 zone)

EMBL: CP001854.PE14

CP001854.PE14        Location/Qualifiers
FT   CDS             16543..17793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0014"
FT                   /product="protein serine/threonine phosphatase"
FT                   /EC_number="3.1.3.16"
FT                   /note="KEGG: ank:AnaeK_3749 protein serine/threonine
FT                   phosphatase; PFAM: Protein phosphatase 2C-like; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48450"
FT                   /db_xref="GOA:D3EYP6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP6"
FT                   /inference="protein motif:PRIAM:3.1.3.16"
FT                   /protein_id="ADB48450.1"
FT                   /translation="MLRVAEHVEKSDTGLARRANEDNFFVRSPLFVVADGMGGAQAGEV
FT                   ASRLAAETFATGLPEGGTVEERLATRVLEANSRIYRLSREDSERAGMGTTLTAIYVDGE
FT                   ELAVAHVGDSRAYLWRDGELTRLTRDHSLVDELVRRGKLTEEEAAEHPQRSIITRALGP
FT                   EPDVEVDTRTYRAQAADVLLLCSDGLTSMISEQHVAELLGAAESLEAAAQALIDAANAA
FT                   GGRDNITVVLFRLEEAAAGAAAEASATAPLDQPTQTGMRAADARTAVAPAEPETAEQPA
FT                   ARAAAREQPPELPAVVAARRRRAERENQPLPRRVKIFAATVSTLIVLTILGIAGMFATR
FT                   AVFFVGTNDQGMVTVYKGLPFDLPAGLKLYSEYSVSGVPAAAVPEPRRKELLDHQLRSR
FT                   SDARDLVAQLELGRLSP"
     MLRVAEHVEK SDTGLARRAN EDNFFVRSPL FVVADGMGGA QAGEVASRLA AETFATGLPE        60
     GGTVEERLAT RVLEANSRIY RLSREDSERA GMGTTLTAIY VDGEELAVAH VGDSRAYLWR       120
     DGELTRLTRD HSLVDELVRR GKLTEEEAAE HPQRSIITRA LGPEPDVEVD TRTYRAQAAD       180
     VLLLCSDGLT SMISEQHVAE LLGAAESLEA AAQALIDAAN AAGGRDNITV VLFRLEEAAA       240
     GAAAEASATA PLDQPTQTGM RAADARTAVA PAEPETAEQP AARAAAREQP PELPAVVAAR       300
     RRRAERENQP LPRRVKIFAA TVSTLIVLTI LGIAGMFATR AVFFVGTNDQ GMVTVYKGLP       360
     FDLPAGLKLY SEYSVSGVPA AAVPEPRRKE LLDHQLRSRS DARDLVAQLE LGRLSP           416
//

If you have problems or comments...

PBIL Back to PBIL home page