(data stored in ACNUC7421 zone)

EMBL: CP001854.PE140

CP001854.PE140       Location/Qualifiers
FT   CDS             complement(142490..142891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0140"
FT                   /product="Class I peptide chain release factor"
FT                   /note="PFAM: Class I peptide chain release factor; KEGG:
FT                   dde:Dde_0202 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48576"
FT                   /db_xref="GOA:D3F4Z8"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z8"
FT                   /inference="protein motif:PFAM:PF00472"
FT                   /protein_id="ADB48576.1"
FT                   /translation="MPITRDVALPLTEVTLRASRSSGPGGQHANVTASRIEAVFDVAAS
FT                   RTLQPWQKERVRARYGPRVTAVAQDARSQALNRELALERLRDRLAGALAVPRHRTPTKP
FT                   SKASRRRRVEAKKRRSEHKRGRQKPRHDD"
     MPITRDVALP LTEVTLRASR SSGPGGQHAN VTASRIEAVF DVAASRTLQP WQKERVRARY        60
     GPRVTAVAQD ARSQALNREL ALERLRDRLA GALAVPRHRT PTKPSKASRR RRVEAKKRRS       120
     EHKRGRQKPR HDD                                                          133
//

If you have problems or comments...

PBIL Back to PBIL home page