(data stored in ACNUC7421 zone)

EMBL: CP001854.PE141

CP001854.PE141       Location/Qualifiers
FT   CDS             142999..143268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0141"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48577"
FT                   /db_xref="UniProtKB/TrEMBL:D3F4Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48577.1"
FT                   /translation="MAKVLVTIEDPLLKRIDRTVRERGLTRSGYLSELARRDLDAQLGP
FT                   GADPQVRAALRRMQDLVAGLDVRSDEDTTSLLRRTRDERLDQLG"
     MAKVLVTIED PLLKRIDRTV RERGLTRSGY LSELARRDLD AQLGPGADPQ VRAALRRMQD        60
     LVAGLDVRSD EDTTSLLRRT RDERLDQLG                                          89
//

If you have problems or comments...

PBIL Back to PBIL home page