(data stored in ACNUC7421 zone)

EMBL: CP001854.PE142

CP001854.PE142       Location/Qualifiers
FT   CDS             143265..143675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0142"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sfu:Sfum_1407 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48578"
FT                   /db_xref="GOA:D3F500"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D3F500"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ADB48578.1"
FT                   /translation="MTEAVLDANVVLKWLRPEEEPREPAAAFLRAAHDAGELRVTAPAL
FT                   LPYEVLNVVGRKWRVDAAALIELATWFGALRFDLVEPPLAEVARWTAAGLSAYDAAYVA
FT                   VAEAAGIELITADAGIVAAAPGIARGLADAAG"
     MTEAVLDANV VLKWLRPEEE PREPAAAFLR AAHDAGELRV TAPALLPYEV LNVVGRKWRV        60
     DAAALIELAT WFGALRFDLV EPPLAEVARW TAAGLSAYDA AYVAVAEAAG IELITADAGI       120
     VAAAPGIARG LADAAG                                                       136
//

If you have problems or comments...

PBIL Back to PBIL home page