(data stored in ACNUC7421 zone)

EMBL: CP001854.PE144

CP001854.PE144       Location/Qualifiers
FT   CDS             complement(144000..144602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0144"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: mxa:MXAN_2207 BioY family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48580"
FT                   /db_xref="GOA:D3F502"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D3F502"
FT                   /inference="protein motif:PFAM:PF02632"
FT                   /protein_id="ADB48580.1"
FT                   /translation="MATAIAPTLPRRGLVLADAIPGARTRDIALVIGGALFTALLAQVA
FT                   IPVPPSPVPVTGQTLAVGLVGATLGARRGTAAMLLYALLGLFLPVYAEGNSGWDVITGA
FT                   SGGYIIGFIFATGVVGYLAERGADRKAVTAFLSFVAAQLIVFAFGLVGLKLAVGQDWSW
FT                   TVHNGFAIFIVGGVIKAIVGAAVLPSAWKLVRRFERG"
     MATAIAPTLP RRGLVLADAI PGARTRDIAL VIGGALFTAL LAQVAIPVPP SPVPVTGQTL        60
     AVGLVGATLG ARRGTAAMLL YALLGLFLPV YAEGNSGWDV ITGASGGYII GFIFATGVVG       120
     YLAERGADRK AVTAFLSFVA AQLIVFAFGL VGLKLAVGQD WSWTVHNGFA IFIVGGVIKA       180
     IVGAAVLPSA WKLVRRFERG                                                   200
//

If you have problems or comments...

PBIL Back to PBIL home page