(data stored in ACNUC7421 zone)

EMBL: CP001854.PE145

CP001854.PE145       Location/Qualifiers
FT   CDS             complement(144816..145472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0145"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48581"
FT                   /db_xref="UniProtKB/TrEMBL:D3F503"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48581.1"
FT                   /translation="MLPFALQAVSECPAPADLALALGAEFEPIAADDAHAALDELGCDL
FT                   AAFRHVAPREQLVACAAAVGNRFTIVEERKRIGRESVFDDLLLHRVLRDGSGHALPLTI
FT                   AAVEAGRRAGIALGAVGRRREQYLAHAGLAAPHVADLRRRGPLVDLTGREEKVGWQCAH
FT                   QLSALLLDRIAERAERIGHLSWALRAAELRLALPVCAETRERMERELERVRTRLN"
     MLPFALQAVS ECPAPADLAL ALGAEFEPIA ADDAHAALDE LGCDLAAFRH VAPREQLVAC        60
     AAAVGNRFTI VEERKRIGRE SVFDDLLLHR VLRDGSGHAL PLTIAAVEAG RRAGIALGAV       120
     GRRREQYLAH AGLAAPHVAD LRRRGPLVDL TGREEKVGWQ CAHQLSALLL DRIAERAERI       180
     GHLSWALRAA ELRLALPVCA ETRERMEREL ERVRTRLN                               218
//

If you have problems or comments...

PBIL Back to PBIL home page