(data stored in ACNUC7421 zone)

EMBL: CP001854.PE146

CP001854.PE146       Location/Qualifiers
FT   CDS             145610..145969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0146"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   bpm:BURPS1710b_A1566 plastocyanin/azurin family copper
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48582"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:D3F504"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADB48582.1"
FT                   /translation="MRRRVTCLALLSTGAAALLPAVTGAAGSSGSPAAHAAATRTVVLR
FT                   DIAFNPSRVTIHRGDRVTWQWRDGRTRHNVTSRSFRSASTRSSGSYSVTFGRPGTFAYH
FT                   CTLHPGMTGSVVVRR"
     MRRRVTCLAL LSTGAAALLP AVTGAAGSSG SPAAHAAATR TVVLRDIAFN PSRVTIHRGD        60
     RVTWQWRDGR TRHNVTSRSF RSASTRSSGS YSVTFGRPGT FAYHCTLHPG MTGSVVVRR        119
//

If you have problems or comments...

PBIL Back to PBIL home page