(data stored in ACNUC7421 zone)

EMBL: CP001854.PE147

CP001854.PE147       Location/Qualifiers
FT   CDS             complement(145973..146386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0147"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; SMART:
FT                   Forkhead-associated protein; KEGG: mfa:Mfla_0494 FHA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48583"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D3F505"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADB48583.1"
FT                   /translation="MTTTPSDRHTIAFEPTEAVDAVQGPADGDRVEAVAHPAPGRYFAM
FT                   EEGGSERLLPLDRTITHLGRGFTADIQLEDVSVSRRHAIVTQRRGAVRILDDRSSNGTF
FT                   VNGRRIQEAELHDGDVVVIGRVVLQYVDVAPTT"
     MTTTPSDRHT IAFEPTEAVD AVQGPADGDR VEAVAHPAPG RYFAMEEGGS ERLLPLDRTI        60
     THLGRGFTAD IQLEDVSVSR RHAIVTQRRG AVRILDDRSS NGTFVNGRRI QEAELHDGDV       120
     VVIGRVVLQY VDVAPTT                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page