(data stored in ACNUC7421 zone)

EMBL: CP001854.PE148

CP001854.PE148       Location/Qualifiers
FT   CDS             146558..147121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0148"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   eba:ebA4517 RNA polymerase sigma factor (sigma24)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48584"
FT                   /db_xref="GOA:D3F506"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D3F506"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ADB48584.1"
FT                   /translation="MSSDAELLEASREDAGAFRELYERYALRVQGYHRRRTRSDDAAHD
FT                   LTAETFAQAWLGRARFRDEAGGSAGPWLFGIARHVLLASVRRGQLERIACERLGLFDRL
FT                   DCRPAAVEPQTAWLEDLDEDLDRALADLPAGQRDAIRLRVVDDLAYEQVAAALDTTPQA
FT                   ARVRVHRGLGALRTKLNHSTEASR"
     MSSDAELLEA SREDAGAFRE LYERYALRVQ GYHRRRTRSD DAAHDLTAET FAQAWLGRAR        60
     FRDEAGGSAG PWLFGIARHV LLASVRRGQL ERIACERLGL FDRLDCRPAA VEPQTAWLED       120
     LDEDLDRALA DLPAGQRDAI RLRVVDDLAY EQVAAALDTT PQAARVRVHR GLGALRTKLN       180
     HSTEASR                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page