(data stored in ACNUC7421 zone)

EMBL: CP001854.PE149

CP001854.PE149       Location/Qualifiers
FT   CDS             147118..147657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0149"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48585"
FT                   /db_xref="GOA:D3F507"
FT                   /db_xref="UniProtKB/TrEMBL:D3F507"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48585.1"
FT                   /translation="MTTDLPPRLARLGDALEQAASADLAGASSAASAPASARARTTAGR
FT                   GRRPRRIALFAAAIAIAIPGAAIAGSQLIDTDEVADSIPAGSLWLAGTEPSCTVVRENV
FT                   EFHCTLGKAPSGEVLADWKGTVEPTVDASKRVNGGCRSLASDGRSWRCYIGSEAVEQRI
FT                   IGAGFLGDYAPTPGAG"
     MTTDLPPRLA RLGDALEQAA SADLAGASSA ASAPASARAR TTAGRGRRPR RIALFAAAIA        60
     IAIPGAAIAG SQLIDTDEVA DSIPAGSLWL AGTEPSCTVV RENVEFHCTL GKAPSGEVLA       120
     DWKGTVEPTV DASKRVNGGC RSLASDGRSW RCYIGSEAVE QRIIGAGFLG DYAPTPGAG        179
//

If you have problems or comments...

PBIL Back to PBIL home page