(data stored in ACNUC7421 zone)

EMBL: CP001854.PE15

CP001854.PE15        Location/Qualifiers
FT   CDS             17790..19097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0015"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: dps:DP2425 cell
FT                   division protein (FtsW)"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48451"
FT                   /db_xref="GOA:D3EYP7"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP7"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ADB48451.1"
FT                   /translation="MSARNRELLGLIPASLLVTAGFAAVFIERGSLSQNELSDLSLTYG
FT                   AIFLGLCVAAHVFLRFALPYADPYLFPLVAVLACFGLVMIYRIDDTLARQQAQWFVVGL
FT                   ILFVATIVFLRDYRKLEQYRYLIAFGSLALLCLPRLPGIGAQVNGAYLGIRIPGVMVFQ
FT                   PTEFAKIGIVVFLASYLRDTRQVLVVGARRVLGVTLPPLKHFGPLLVIWGMAMLLLVVI
FT                   RDLGSSLMFFGAFLALIYVATDRFSFVLIGLVLFGLGGWYLGNTVPHVIDRVDVWMDPL
FT                   NPARYGNEGYQIANSLFAQADGGVLGRGFGGAMLESPFGDPILPAAQTDLIYALIVNEV
FT                   GLVGAVAVLMVYLLVVQRGFKIALLARDSFSTLLAVGLSAVFALQVFVIVGGVTNVIPL
FT                   TGVTLPFISYGGSSILANFVLLALLLLVSDKARRPA"
     MSARNRELLG LIPASLLVTA GFAAVFIERG SLSQNELSDL SLTYGAIFLG LCVAAHVFLR        60
     FALPYADPYL FPLVAVLACF GLVMIYRIDD TLARQQAQWF VVGLILFVAT IVFLRDYRKL       120
     EQYRYLIAFG SLALLCLPRL PGIGAQVNGA YLGIRIPGVM VFQPTEFAKI GIVVFLASYL       180
     RDTRQVLVVG ARRVLGVTLP PLKHFGPLLV IWGMAMLLLV VIRDLGSSLM FFGAFLALIY       240
     VATDRFSFVL IGLVLFGLGG WYLGNTVPHV IDRVDVWMDP LNPARYGNEG YQIANSLFAQ       300
     ADGGVLGRGF GGAMLESPFG DPILPAAQTD LIYALIVNEV GLVGAVAVLM VYLLVVQRGF       360
     KIALLARDSF STLLAVGLSA VFALQVFVIV GGVTNVIPLT GVTLPFISYG GSSILANFVL       420
     LALLLLVSDK ARRPA                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page