(data stored in ACNUC7421 zone)

EMBL: CP001854.PE150

CP001854.PE150       Location/Qualifiers
FT   CDS             complement(147688..149403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0150"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mxa:MXAN_5598 OmpA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48586"
FT                   /db_xref="UniProtKB/TrEMBL:D3F508"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48586.1"
FT                   /translation="MDLIRKSPARRLGRWPALVLAALVAALALGATTAQTASADNFSCR
FT                   ASALRVDALVAGLGVDAEPTVANNGENPCAGESRRLVTLPPVLASVVSGGVSEADTTVS
FT                   ATGATARGAITDVALLRLLLGGVGLRATEATAGYQCVNGSPVPQTGGQVTGLTLFGTSV
FT                   LDTSAPVTLDLSANLLLGTLRLGTISLNQTTTTATSVTRTAVRITIAPNVDLGLLGILQ
FT                   PVLGPVLRGLLGADVVLGEARAGLVGNPCPPVVTPPTPRPPITPTETPVDPSLRPPIID
FT                   DGPPPRTPLTNATLLYHSTDSNVTLECRLDGGAWGACNGRSDYSNLSLGQHCFDVRSRR
FT                   GDRVSATTRYCWTVTELPAGCVASYRHGYFIKAGNAALGRRQAVFHATSRDGRIILTTR
FT                   SAPGILKLVQYTLNGARLASTANHVVEFAQLDKTRSQSLQVSVRGNGRSGRITRNFRYV
FT                   NYVALDCEGREVADGIAPRTVTVGGNRVTVKPDVPNEIRGTTKLRFFVQPARRHSLRAV
FT                   SFAINGRPLRQHLRSAVLTATQLKAGGAQTLTVRLTPNRGAPKTVTFTFTTNKT"
     MDLIRKSPAR RLGRWPALVL AALVAALALG ATTAQTASAD NFSCRASALR VDALVAGLGV        60
     DAEPTVANNG ENPCAGESRR LVTLPPVLAS VVSGGVSEAD TTVSATGATA RGAITDVALL       120
     RLLLGGVGLR ATEATAGYQC VNGSPVPQTG GQVTGLTLFG TSVLDTSAPV TLDLSANLLL       180
     GTLRLGTISL NQTTTTATSV TRTAVRITIA PNVDLGLLGI LQPVLGPVLR GLLGADVVLG       240
     EARAGLVGNP CPPVVTPPTP RPPITPTETP VDPSLRPPII DDGPPPRTPL TNATLLYHST       300
     DSNVTLECRL DGGAWGACNG RSDYSNLSLG QHCFDVRSRR GDRVSATTRY CWTVTELPAG       360
     CVASYRHGYF IKAGNAALGR RQAVFHATSR DGRIILTTRS APGILKLVQY TLNGARLAST       420
     ANHVVEFAQL DKTRSQSLQV SVRGNGRSGR ITRNFRYVNY VALDCEGREV ADGIAPRTVT       480
     VGGNRVTVKP DVPNEIRGTT KLRFFVQPAR RHSLRAVSFA INGRPLRQHL RSAVLTATQL       540
     KAGGAQTLTV RLTPNRGAPK TVTFTFTTNK T                                      571
//

If you have problems or comments...

PBIL Back to PBIL home page