(data stored in ACNUC7421 zone)

EMBL: CP001854.PE151

CP001854.PE151       Location/Qualifiers
FT   CDS             149745..150413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0151"
FT                   /product="Chlorite dismutase"
FT                   /note="PFAM: Chlorite dismutase; KEGG: dar:Daro_2580
FT                   chlorite dismutase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48587"
FT                   /db_xref="InterPro:IPR010644"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D3F509"
FT                   /inference="protein motif:PFAM:PF06778"
FT                   /protein_id="ADB48587.1"
FT                   /translation="MTTDQNLYTLYAAFGAPAVRRLPEARRAAAAEEAQAALDAADVVV
FT                   RGSYSLAGFRAEADLLLWLVAASADALQDAVVAFRHTELGRSLDAHWTNIGVHREAEFA
FT                   KSHIPAYLAGKEPGRYVCVYPFVRSLDWYLLEPDARARMLREHGMMGRDYPDVLANTVS
FT                   AFALGDYEWLLAFEAEELTRIVDLMRHLRAAEARRHTREELPFFTGIRKGLADVVADLP
FT                   "
     MTTDQNLYTL YAAFGAPAVR RLPEARRAAA AEEAQAALDA ADVVVRGSYS LAGFRAEADL        60
     LLWLVAASAD ALQDAVVAFR HTELGRSLDA HWTNIGVHRE AEFAKSHIPA YLAGKEPGRY       120
     VCVYPFVRSL DWYLLEPDAR ARMLREHGMM GRDYPDVLAN TVSAFALGDY EWLLAFEAEE       180
     LTRIVDLMRH LRAAEARRHT REELPFFTGI RKGLADVVAD LP                          222
//

If you have problems or comments...

PBIL Back to PBIL home page