(data stored in ACNUC7421 zone)

EMBL: CP001854.PE152

CP001854.PE152       Location/Qualifiers
FT   CDS             150526..150981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0152"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48588"
FT                   /db_xref="UniProtKB/TrEMBL:D3F510"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48588.1"
FT                   /translation="MSDTLLAAIVGAVATLAAVGFAQLLNHAREARRARKASDEAWGRI
FT                   EIELGNVRESLDGIRVDDAWPIGWNAGWWSVWEKHSDALRCESDEERERFRTVQRAFGT
FT                   IDQLQHGVNTRRPDDGRGFTARDREFLDRVRAAIEAASGAVAGTARR"
     MSDTLLAAIV GAVATLAAVG FAQLLNHARE ARRARKASDE AWGRIEIELG NVRESLDGIR        60
     VDDAWPIGWN AGWWSVWEKH SDALRCESDE ERERFRTVQR AFGTIDQLQH GVNTRRPDDG       120
     RGFTARDREF LDRVRAAIEA ASGAVAGTAR R                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page