(data stored in ACNUC7421 zone)

EMBL: CP001854.PE153

CP001854.PE153       Location/Qualifiers
FT   CDS             complement(150988..151911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0153"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; NADH pyrophosphatase-like;
FT                   Zinc ribbon NADH pyrophosphatase; KEGG: pla:Plav_0254 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48589"
FT                   /db_xref="GOA:D3F511"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D3F511"
FT                   /inference="protein motif:PRIAM:3.6.1.22"
FT                   /protein_id="ADB48589.1"
FT                   /translation="MAEPNTFSGAQLDRASARRSDAAWVQARLHDRSSRALAITRDGVL
FT                   VTGYAEPQLVRLALDQIPGGAGATALLGVEPDGTTLFAVDVDHIHALRPLAPGARPLSL
FT                   REAGALLPHHLGGLAAYASALLNWHRVHGHCARCGAVTDVAEGGHMRRCPVCGAEHHPR
FT                   TDPVVIMLVLDGERVLLGRQAAWPAGRYSALAGFVEAGESLEEAVAREVLEESGVHVRE
FT                   PHYVSSQPWPFPSSLMLGFTATYAGGEPAALDGELEDVRWFTRAEVAAAAALPASADWD
FT                   DAPAGTSLLLPPPLAIARRLLDGWLG"
     MAEPNTFSGA QLDRASARRS DAAWVQARLH DRSSRALAIT RDGVLVTGYA EPQLVRLALD        60
     QIPGGAGATA LLGVEPDGTT LFAVDVDHIH ALRPLAPGAR PLSLREAGAL LPHHLGGLAA       120
     YASALLNWHR VHGHCARCGA VTDVAEGGHM RRCPVCGAEH HPRTDPVVIM LVLDGERVLL       180
     GRQAAWPAGR YSALAGFVEA GESLEEAVAR EVLEESGVHV REPHYVSSQP WPFPSSLMLG       240
     FTATYAGGEP AALDGELEDV RWFTRAEVAA AAALPASADW DDAPAGTSLL LPPPLAIARR       300
     LLDGWLG                                                                 307
//

If you have problems or comments...

PBIL Back to PBIL home page