(data stored in ACNUC7421 zone)

EMBL: CP001854.PE154

CP001854.PE154       Location/Qualifiers
FT   CDS             151989..152594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0154"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: lch:Lcho_4033
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48590"
FT                   /db_xref="GOA:D3F512"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D3F512"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADB48590.1"
FT                   /translation="MARRTAAAARATRDAIVARAVEIGSVDGLEGITIGRLADDLGLSK
FT                   SGVLNHFRTKELLQLAALSSAEEIFRREVWEPARDEPPGLRRLIALEDAWIDHVTGDAF
FT                   PGGCFWTAASAEFDGRPGSVRETVADALERWYATVRREVRAAMEAGELPPGTDPEQIVF
FT                   ELRGVAMTTNQQVQLHNDPAARDRARAAVRHILGSIAN"
     MARRTAAAAR ATRDAIVARA VEIGSVDGLE GITIGRLADD LGLSKSGVLN HFRTKELLQL        60
     AALSSAEEIF RREVWEPARD EPPGLRRLIA LEDAWIDHVT GDAFPGGCFW TAASAEFDGR       120
     PGSVRETVAD ALERWYATVR REVRAAMEAG ELPPGTDPEQ IVFELRGVAM TTNQQVQLHN       180
     DPAARDRARA AVRHILGSIA N                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page