(data stored in ACNUC7421 zone)

EMBL: CP001854.PE155

CP001854.PE155       Location/Qualifiers
FT   CDS             152667..154130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0155"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bvi:Bcep1808_4007 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48591"
FT                   /db_xref="GOA:D3F513"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D3F513"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ADB48591.1"
FT                   /translation="MSGPAAPAATPLGSESPPAAPRPGRAIAVASAATFVAFLDVTVVN
FT                   VALPDLQRDFAGASLVTLSWVVAIYGVLFAALLTPAGRLADVIGRKTVFLAGFAGFTVT
FT                   SAISAVAPSVGLLIAARALQGASAAFMIPAALGIVLAVSAPEKRAAAVGLWGATTSVAA
FT                   AAGPALGGLLIDAFDWRAVFLINVPIGLVVLWAGWRVLPSIGRGAQQLPDLIGSALLAA
FT                   GFALVLVALTETAEWGWVDGRTAACLVAGVALLAVVLRRTRSHPAPAIELALLRNRAFA
FT                   VASAGAALYGVALFAWMLACVLFVTSVWGYSIIEAGLAVTPGAFSSAVAAVFAGRVVDR
FT                   HGPRGVVAGASLLFAAAGVWCVLGISAEPRFLTFWLPLGIVGGAGMGAVTVGLTGAAAR
FT                   ALPPAQFASGTGLAMTARQLGGALGVAALATILESAGVGVAGFRAVFAMCTVAALLTAL
FT                   SALWLARPAPTAAPAAAPLEPSKTAEVVA"
     MSGPAAPAAT PLGSESPPAA PRPGRAIAVA SAATFVAFLD VTVVNVALPD LQRDFAGASL        60
     VTLSWVVAIY GVLFAALLTP AGRLADVIGR KTVFLAGFAG FTVTSAISAV APSVGLLIAA       120
     RALQGASAAF MIPAALGIVL AVSAPEKRAA AVGLWGATTS VAAAAGPALG GLLIDAFDWR       180
     AVFLINVPIG LVVLWAGWRV LPSIGRGAQQ LPDLIGSALL AAGFALVLVA LTETAEWGWV       240
     DGRTAACLVA GVALLAVVLR RTRSHPAPAI ELALLRNRAF AVASAGAALY GVALFAWMLA       300
     CVLFVTSVWG YSIIEAGLAV TPGAFSSAVA AVFAGRVVDR HGPRGVVAGA SLLFAAAGVW       360
     CVLGISAEPR FLTFWLPLGI VGGAGMGAVT VGLTGAAARA LPPAQFASGT GLAMTARQLG       420
     GALGVAALAT ILESAGVGVA GFRAVFAMCT VAALLTALSA LWLARPAPTA APAAAPLEPS       480
     KTAEVVA                                                                 487
//

If you have problems or comments...

PBIL Back to PBIL home page