(data stored in ACNUC7421 zone)

EMBL: CP001854.PE156

CP001854.PE156       Location/Qualifiers
FT   CDS             154127..154897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0156"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   acp:A2cp1_0086 lipolytic protein G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48592"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D3F514"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ADB48592.1"
FT                   /translation="MTTYPNELADPDVLGGHEEHALLRGAPWRRFAVLGDSVAAGVGER
FT                   VDGYLALTWAERVARGLRSHHPGLAYLNLGVRDLRAQQVRETQLAPALTFAPDLAAVIA
FT                   GGNDLLSRRFDPDAVARELEAIVAPLRDVGAEVFMFRLLDITLAIDVPEPYGTRLSERL
FT                   AALNDATSAVAERQQALVVAGAAHTRAADPPMYSSDLMHLNLRGQAVIGSEAIRELSRV
FT                   LAPPVEGEPLGLRPRVPSEELAQGLVLPAVESGG"
     MTTYPNELAD PDVLGGHEEH ALLRGAPWRR FAVLGDSVAA GVGERVDGYL ALTWAERVAR        60
     GLRSHHPGLA YLNLGVRDLR AQQVRETQLA PALTFAPDLA AVIAGGNDLL SRRFDPDAVA       120
     RELEAIVAPL RDVGAEVFMF RLLDITLAID VPEPYGTRLS ERLAALNDAT SAVAERQQAL       180
     VVAGAAHTRA ADPPMYSSDL MHLNLRGQAV IGSEAIRELS RVLAPPVEGE PLGLRPRVPS       240
     EELAQGLVLP AVESGG                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page