(data stored in ACNUC7421 zone)

EMBL: CP001854.PE157

CP001854.PE157       Location/Qualifiers
FT   CDS             154894..155436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0157"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: oan:Oant_4146 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48593"
FT                   /db_xref="GOA:D3F515"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D3F515"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ADB48593.1"
FT                   /translation="MSWTTLDSRIAYENRWIRVREDAVLRPDGERGIYGVVEMVAPAVF
FT                   VVALTEADEVVLITQRRYTTGQISVEVPAGATDGEEPLVAAQRELREETGLAAAEWRAL
FT                   GSMFALNGIADAPEHVFLATGLSDAGAGDERAAEGITAVERVPFAEAMRMMRDGEISDG
FT                   ETIASLALAAVALGRFA"
     MSWTTLDSRI AYENRWIRVR EDAVLRPDGE RGIYGVVEMV APAVFVVALT EADEVVLITQ        60
     RRYTTGQISV EVPAGATDGE EPLVAAQREL REETGLAAAE WRALGSMFAL NGIADAPEHV       120
     FLATGLSDAG AGDERAAEGI TAVERVPFAE AMRMMRDGEI SDGETIASLA LAAVALGRFA       180
//

If you have problems or comments...

PBIL Back to PBIL home page