(data stored in ACNUC7421 zone)

EMBL: CP001854.PE158

CP001854.PE158       Location/Qualifiers
FT   CDS             complement(155528..156067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48594"
FT                   /db_xref="InterPro:IPR009288"
FT                   /db_xref="InterPro:IPR013024"
FT                   /db_xref="InterPro:IPR036568"
FT                   /db_xref="UniProtKB/TrEMBL:D3F516"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48594.1"
FT                   /translation="MAGDWVFGYGSLAAEAHDGYVTALAGHRRRWGVAMDNARDLPGYK
FT                   WYRLCASGERPRGVVAFLDVVAGRGAVNGVCLPVDAGELRRLDARERNYERVEVTELVA
FT                   EARGRVWAYVGSAAGRARLAAGLRDGRALVSREYLDDVEDGFRRLGDEQLAAYRASTDP
FT                   PPPGCAVVALERVDLP"
     MAGDWVFGYG SLAAEAHDGY VTALAGHRRR WGVAMDNARD LPGYKWYRLC ASGERPRGVV        60
     AFLDVVAGRG AVNGVCLPVD AGELRRLDAR ERNYERVEVT ELVAEARGRV WAYVGSAAGR       120
     ARLAAGLRDG RALVSREYLD DVEDGFRRLG DEQLAAYRAS TDPPPPGCAV VALERVDLP        179
//

If you have problems or comments...

PBIL Back to PBIL home page