(data stored in ACNUC7421 zone)

EMBL: CP001854.PE159

CP001854.PE159       Location/Qualifiers
FT   CDS             complement(156079..157707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0159"
FT                   /product="Cellulase"
FT                   /EC_number="3.2.1.4"
FT                   /note="PFAM: glycoside hydrolase family 5; KEGG:
FT                   xca:xccb100_0675 exported cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48595"
FT                   /db_xref="GOA:D3F517"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D3F517"
FT                   /inference="protein motif:PRIAM:3.2.1.4"
FT                   /protein_id="ADB48595.1"
FT                   /translation="MRRLAPLILAGLLLASLGAATAHAGGRMISTPLSTKGARIVDAGG
FT                   RTVVLQGVNWFGFETANHLVHGLWARDYRDVLAQVRRLGFNTIRLPFSLEAIRSTAPVS
FT                   GADFSGGRNAALKGATPLEAMDAVVEEAGRQGLLILLDNHSHADDAYQQGLWYGQGFSE
FT                   DDWVATWKRLAARYRDQRNVIGADLKNEPHAEATWGTGGPTDWRRAAERAGNAVLSVAP
FT                   QWLVVVEGVGGGAPVPGQRLDTHWWGGNLEGVRTHPVRLDRANRLVYSPHEYGPGVFPQ
FT                   PWFGKPNTPALLEERWRTGFGFIAEQGIAPILVGEFGGRNVDRESAEGRWQRQFFDFIG
FT                   RTGASWTYWALNPNSGDTGGVLKDDWSSVQPAKTALLQRMIARQRIAFRGSGAVFTAPR
FT                   RATTPRRGGKAAPKTPARSQTAAPTQPSAPAQPPAQPPADDAPGPPAPGSLSARVVVEN
FT                   RWDAGWCGHLEVSGPDATLAAARATLTLPPGTRIAQSWNAQRSGDGGRVELRFPAWAKV
FT                   AGGAPYAATGFCVDGSGEAADVTVG"
     MRRLAPLILA GLLLASLGAA TAHAGGRMIS TPLSTKGARI VDAGGRTVVL QGVNWFGFET        60
     ANHLVHGLWA RDYRDVLAQV RRLGFNTIRL PFSLEAIRST APVSGADFSG GRNAALKGAT       120
     PLEAMDAVVE EAGRQGLLIL LDNHSHADDA YQQGLWYGQG FSEDDWVATW KRLAARYRDQ       180
     RNVIGADLKN EPHAEATWGT GGPTDWRRAA ERAGNAVLSV APQWLVVVEG VGGGAPVPGQ       240
     RLDTHWWGGN LEGVRTHPVR LDRANRLVYS PHEYGPGVFP QPWFGKPNTP ALLEERWRTG       300
     FGFIAEQGIA PILVGEFGGR NVDRESAEGR WQRQFFDFIG RTGASWTYWA LNPNSGDTGG       360
     VLKDDWSSVQ PAKTALLQRM IARQRIAFRG SGAVFTAPRR ATTPRRGGKA APKTPARSQT       420
     AAPTQPSAPA QPPAQPPADD APGPPAPGSL SARVVVENRW DAGWCGHLEV SGPDATLAAA       480
     RATLTLPPGT RIAQSWNAQR SGDGGRVELR FPAWAKVAGG APYAATGFCV DGSGEAADVT       540
     VG                                                                      542
//

If you have problems or comments...

PBIL Back to PBIL home page