(data stored in ACNUC7421 zone)

EMBL: CP001854.PE16

CP001854.PE16        Location/Qualifiers
FT   CDS             19109..20545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0016"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: sat:SYN_00551 cell elongation specific D,D-
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48452"
FT                   /db_xref="GOA:D3EYP8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYP8"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ADB48452.1"
FT                   /translation="MRLFLAIVLLFVILIAWTSRWSVFGAEALRENPLDKRPLFAGLQV
FT                   KRGAITAAGGEVLAKSVRVRRKGGSIYEREYPTDSLFGHPVGYANLLFGQLSGLERSRN
FT                   DELTGTTSELNSIVDQLQGKRRAGNTVVTTLDADAQRVATDALGGQKGAIVAIEPKTGA
FT                   VKTMVSSPGYDPNDVRDPDALSALNRDTENAPLLDRVTQGTYPPGSTFKVVTASAAIDS
FT                   GQFTPDSVLNGDTGKVISGTPLNNDSNVSYGDIDLRTALKNSVNVVWAQVAERLGKQTM
FT                   ADYMDRFGFYRLPPLDYPKDQMIASGERGPNGRLIPVTSPLVDVGRMAIGQDKLTVTPL
FT                   QMAMVVSAVANGGKLMKPHLTDKVVDPDGRTVDTIEPETWSEPISSQTAAEMTTMMRSV
FT                   VDDGTGTAVQIPGLDIAAKTGTAQVGAPGSGLTQPWFVAFAPANDPQIALAVTVERSQG
FT                   GSGGTVAAPIARQVFESLLR"
     MRLFLAIVLL FVILIAWTSR WSVFGAEALR ENPLDKRPLF AGLQVKRGAI TAAGGEVLAK        60
     SVRVRRKGGS IYEREYPTDS LFGHPVGYAN LLFGQLSGLE RSRNDELTGT TSELNSIVDQ       120
     LQGKRRAGNT VVTTLDADAQ RVATDALGGQ KGAIVAIEPK TGAVKTMVSS PGYDPNDVRD       180
     PDALSALNRD TENAPLLDRV TQGTYPPGST FKVVTASAAI DSGQFTPDSV LNGDTGKVIS       240
     GTPLNNDSNV SYGDIDLRTA LKNSVNVVWA QVAERLGKQT MADYMDRFGF YRLPPLDYPK       300
     DQMIASGERG PNGRLIPVTS PLVDVGRMAI GQDKLTVTPL QMAMVVSAVA NGGKLMKPHL       360
     TDKVVDPDGR TVDTIEPETW SEPISSQTAA EMTTMMRSVV DDGTGTAVQI PGLDIAAKTG       420
     TAQVGAPGSG LTQPWFVAFA PANDPQIALA VTVERSQGGS GGTVAAPIAR QVFESLLR         478
//

If you have problems or comments...

PBIL Back to PBIL home page