(data stored in ACNUC7421 zone)

EMBL: CP001854.PE160

CP001854.PE160       Location/Qualifiers
FT   CDS             complement(157835..157969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48596"
FT                   /db_xref="GOA:D3F518"
FT                   /db_xref="UniProtKB/TrEMBL:D3F518"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48596.1"
FT                   /translation="MRDTLNNVLSTPVDIGWKVLIVLTLLSTLEMTRNLLRRVRHIFP"
     MRDTLNNVLS TPVDIGWKVL IVLTLLSTLE MTRNLLRRVR HIFP                         44
//

If you have problems or comments...

PBIL Back to PBIL home page