(data stored in ACNUC7421 zone)

EMBL: CP001854.PE161

CP001854.PE161       Location/Qualifiers
FT   CDS             complement(157972..159399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0161"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   xac:XAC1811 N-glycosyltransferase PgaC"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48597"
FT                   /db_xref="GOA:D3F519"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D3F519"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ADB48597.1"
FT                   /translation="MAADRTTSTTDATRSRSPHEDGTKRPARRPSHPRRLRGRLGRQQR
FT                   KAQQRQASGTALVPYEQPTTEAAPQPRQGISNKLTQLYWNASMAMHRFQNRPPKTRTAK
FT                   IVVVVPAHNEEGTIAGVLQALLAQTRRPERIVVVADNCTDKTVEIARRFGRRVTVIETV
FT                   GNRDRKVGALRMAWQQYVAYGYDYMLGVDADTILSPDSLAALEDELEESPKAGGVMARY
FT                   TFDPDLGQSRWARLLVRMQRLEFASWTIDILHRKRNTYVLGGQATLFRVSALQQIVDEE
FT                   RRLSPWDPEAQVEDMELTWMLSTRDWETKVSATARAYAGPMLTIRSLWAQRRKWDEGMI
FT                   RLLLGSKIGATTMYPWRVQLKNGINALTRGLFVLLLGTSLLIGAFEWNWIWVVPPILAA
FT                   LLNFKHARKVPNHTRLDLFLAGTLVMVEIYLWFRLLAWVTSWATVVVGIRRDGWARQYK
FT                   AEGLPAGQTMIATGEVV"
     MAADRTTSTT DATRSRSPHE DGTKRPARRP SHPRRLRGRL GRQQRKAQQR QASGTALVPY        60
     EQPTTEAAPQ PRQGISNKLT QLYWNASMAM HRFQNRPPKT RTAKIVVVVP AHNEEGTIAG       120
     VLQALLAQTR RPERIVVVAD NCTDKTVEIA RRFGRRVTVI ETVGNRDRKV GALRMAWQQY       180
     VAYGYDYMLG VDADTILSPD SLAALEDELE ESPKAGGVMA RYTFDPDLGQ SRWARLLVRM       240
     QRLEFASWTI DILHRKRNTY VLGGQATLFR VSALQQIVDE ERRLSPWDPE AQVEDMELTW       300
     MLSTRDWETK VSATARAYAG PMLTIRSLWA QRRKWDEGMI RLLLGSKIGA TTMYPWRVQL       360
     KNGINALTRG LFVLLLGTSL LIGAFEWNWI WVVPPILAAL LNFKHARKVP NHTRLDLFLA       420
     GTLVMVEIYL WFRLLAWVTS WATVVVGIRR DGWARQYKAE GLPAGQTMIA TGEVV            475
//

If you have problems or comments...

PBIL Back to PBIL home page