(data stored in ACNUC7421 zone)

EMBL: CP001854.PE162

CP001854.PE162       Location/Qualifiers
FT   CDS             159505..160281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0162"
FT                   /product="putative signal transduction histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: gsu:GSU0681 sensory box histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48598"
FT                   /db_xref="GOA:D3F520"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D3F520"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADB48598.1"
FT                   /translation="MGARQMRKRRPKNRSFDMALKQSGTIADISKVKRPAPTLSVPRPM
FT                   ADAAVVQAAVETERAHTRAWLHDSVLQVLEYIASGGYADEPDAAALSRVAADAAAELRA
FT                   YVEGDTAQEAAGGHGELCERLCIVVAEERALADHEIGLIFGEQERELTGRQAEQLAAAT
FT                   AEALRNTRKHARATRALVTCDVVGAAATVIVSDDGAGFDVAGVRRGGAGLRESIVGRLA
FT                   REGGAATIRSRPGHGTRVTLRLPLDAGADAEQGRAA"
     MGARQMRKRR PKNRSFDMAL KQSGTIADIS KVKRPAPTLS VPRPMADAAV VQAAVETERA        60
     HTRAWLHDSV LQVLEYIASG GYADEPDAAA LSRVAADAAA ELRAYVEGDT AQEAAGGHGE       120
     LCERLCIVVA EERALADHEI GLIFGEQERE LTGRQAEQLA AATAEALRNT RKHARATRAL       180
     VTCDVVGAAA TVIVSDDGAG FDVAGVRRGG AGLRESIVGR LAREGGAATI RSRPGHGTRV       240
     TLRLPLDAGA DAEQGRAA                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page