(data stored in ACNUC7421 zone)

EMBL: CP001854.PE163

CP001854.PE163       Location/Qualifiers
FT   CDS             160278..160919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0163"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; Sigma-70 region 4 type 2; LexA DNA-binding
FT                   domain protein; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: dat:HRM2_24220 TRAP-type
FT                   C4-dicarboxylate transporter, periplasmic solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48599"
FT                   /db_xref="GOA:D3F521"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D3F521"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADB48599.1"
FT                   /translation="MNIRVLVVEDFPLVRDGVVDALSRDPGIEVVGAAVDGREGLALAH
FT                   ELRPDVIVLDLHMPEIGGMMVLERLRTELPSAKSIVMTATEKAEPLLDAIAAGAAGYLT
FT                   KRTSGEELRQAILTVHGGGSVIAPQLAPHLLQAYSRASTGEAPDVRKKLTATEHEVLRL
FT                   VAQGMTDRQIAERLFVSPRTVQNHLARIREKTSMRRRSDLARWAVLHAVY"
     MNIRVLVVED FPLVRDGVVD ALSRDPGIEV VGAAVDGREG LALAHELRPD VIVLDLHMPE        60
     IGGMMVLERL RTELPSAKSI VMTATEKAEP LLDAIAAGAA GYLTKRTSGE ELRQAILTVH       120
     GGGSVIAPQL APHLLQAYSR ASTGEAPDVR KKLTATEHEV LRLVAQGMTD RQIAERLFVS       180
     PRTVQNHLAR IREKTSMRRR SDLARWAVLH AVY                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page