(data stored in ACNUC7421 zone)

EMBL: CP001854.PE164

CP001854.PE164       Location/Qualifiers
FT   CDS             160919..161512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fph:Fphi_1882 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48600"
FT                   /db_xref="GOA:D3F522"
FT                   /db_xref="InterPro:IPR025671"
FT                   /db_xref="UniProtKB/TrEMBL:D3F522"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48600.1"
FT                   /translation="MSALADRTHGRWPWLAAAAAPASTVALIAVRDRLGEDVRWALWTA
FT                   PAALLWHQTEEWFWPGGFLPWFNREVIGSEQDEFPITRGGGLVINVAIGWGVTAAAARG
FT                   GMRTPALGASALAVNVANGAMHVALAVRRRERNPGAVTSALLFLPLGVAGLAAIARDPR
FT                   GGTRPVVIGLAVGAASGVGTFAAMRRRLARAAAR"
     MSALADRTHG RWPWLAAAAA PASTVALIAV RDRLGEDVRW ALWTAPAALL WHQTEEWFWP        60
     GGFLPWFNRE VIGSEQDEFP ITRGGGLVIN VAIGWGVTAA AARGGMRTPA LGASALAVNV       120
     ANGAMHVALA VRRRERNPGA VTSALLFLPL GVAGLAAIAR DPRGGTRPVV IGLAVGAASG       180
     VGTFAAMRRR LARAAAR                                                      197
//

If you have problems or comments...

PBIL Back to PBIL home page