(data stored in ACNUC7421 zone)

EMBL: CP001854.PE165

CP001854.PE165       Location/Qualifiers
FT   CDS             161543..161971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0165"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: oan:Oant_0062
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48601"
FT                   /db_xref="GOA:D3F523"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D3F523"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ADB48601.1"
FT                   /translation="MPTAFVHTCIRARDVEASLRFYELLGFERRGRLVFESAYNIYMGL
FT                   PGDGDTFELTVNVGRTEPYDLGDGYNHMALTVDDLDALLATLAQAGIEPEKPPYAPGGR
FT                   DEVGRICFVADPDGYRVELIDGGAFATPQDPPHPAGGA"
     MPTAFVHTCI RARDVEASLR FYELLGFERR GRLVFESAYN IYMGLPGDGD TFELTVNVGR        60
     TEPYDLGDGY NHMALTVDDL DALLATLAQA GIEPEKPPYA PGGRDEVGRI CFVADPDGYR       120
     VELIDGGAFA TPQDPPHPAG GA                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page