(data stored in ACNUC7421 zone)

EMBL: CP001854.PE166

CP001854.PE166       Location/Qualifiers
FT   CDS             162096..163763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0166"
FT                   /product="Protein of unknown function DUF1800"
FT                   /note="PFAM: Protein of unknown function DUF1800; KEGG:
FT                   bcj:BCAL2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48602"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:D3F524"
FT                   /inference="protein motif:PFAM:PF08811"
FT                   /protein_id="ADB48602.1"
FT                   /translation="MRRSSKPSKQRRPRRKPCRRPARGKRGKQPASCRRAPAKRRAPAS
FT                   RAPAPKRPPRRAPDAESPHPALPTIPNGTPVPGLPPEAAPPTPPPGEQPPGTPPPEQPP
FT                   SVPRPPGLLRYDGPFGVAQATRLQWRAGFGPRRGEAAQLAALGLDGAVTALTRASGPAQ
FT                   LVGPAPYTEFDDRLEPGVRFEHDHLAWLDRMVRSTQPFVERMALLWHDWFGISDDNVGQ
FT                   YTLLARHVELFRTHGRGSFRDLARMVMEDGAMLVRLNGVGNQRHRPNENFARELMELFT
FT                   LGPDRGAYAERDIREAARGLTGYEGDFRQPNGWQSFWFDPQWHDTTNKEIFGRVAPYDP
FT                   DDVVDACITHRLHPSFFVLKLWSAFVAQPPPPDQRVLLERLYVERGHAVMPVVEAILTH
FT                   PAVYEGPPLVKPPVVYAAGLMRALGAGIEAIGWTGYTANAGQRLHYPPTIAGWREDRWL
FT                   DTSTLHARWKLADLALKGRHLTAESPYPADETPQQAVAMALRFWDDPPLHGDTVAVLVE
FT                   TAERIGRLSTGVSASGRNALRQTILRHLAITSPDAQVC"
     MRRSSKPSKQ RRPRRKPCRR PARGKRGKQP ASCRRAPAKR RAPASRAPAP KRPPRRAPDA        60
     ESPHPALPTI PNGTPVPGLP PEAAPPTPPP GEQPPGTPPP EQPPSVPRPP GLLRYDGPFG       120
     VAQATRLQWR AGFGPRRGEA AQLAALGLDG AVTALTRASG PAQLVGPAPY TEFDDRLEPG       180
     VRFEHDHLAW LDRMVRSTQP FVERMALLWH DWFGISDDNV GQYTLLARHV ELFRTHGRGS       240
     FRDLARMVME DGAMLVRLNG VGNQRHRPNE NFARELMELF TLGPDRGAYA ERDIREAARG       300
     LTGYEGDFRQ PNGWQSFWFD PQWHDTTNKE IFGRVAPYDP DDVVDACITH RLHPSFFVLK       360
     LWSAFVAQPP PPDQRVLLER LYVERGHAVM PVVEAILTHP AVYEGPPLVK PPVVYAAGLM       420
     RALGAGIEAI GWTGYTANAG QRLHYPPTIA GWREDRWLDT STLHARWKLA DLALKGRHLT       480
     AESPYPADET PQQAVAMALR FWDDPPLHGD TVAVLVETAE RIGRLSTGVS ASGRNALRQT       540
     ILRHLAITSP DAQVC                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page