(data stored in ACNUC7421 zone)

EMBL: CP001854.PE167

CP001854.PE167       Location/Qualifiers
FT   CDS             163763..165127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0167"
FT                   /product="protein of unknown function DUF1501"
FT                   /note="PFAM: protein of unknown function DUF1501; KEGG:
FT                   mxa:MXAN_6390 Tat pathway signal sequence domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48603"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:D3F525"
FT                   /inference="protein motif:PFAM:PF07394"
FT                   /protein_id="ADB48603.1"
FT                   /translation="MHRSCDEFTRASAARSGRATAGDGLPAIEPGMPLPAGTGMTRRSL
FT                   LLGGAGLALTIFGGRALAPQAFAEGLDAAAAAAPDAPVIVSVFLSGGVDSIALLAPVED
FT                   PRYTRALRPSLFVEPAATLPASGTTAMRWHPSAAAFKELHDRGRLTVFPAIGYEHANGS
FT                   HFTSRHFYEVGATDPDSATGWLGRYLDIVGEDHNPVQGFTVGPTLSPSLASARVAVAAA
FT                   EAPQAYDFVSPGIEGGPFKDELVRGHAAIGRLTSTDPVLGPARAMHRDAADLRAALSAP
FT                   LPGTSVSYPAGRLGQRLRDVVRLLAAGLPIRCATVDATADFDTHAGQRDTFTEQIAEAG
FT                   AALAAFQADLESRPGLADRVLTIAWSEFGRRPEENGSAGTDHGAGGVGFLLGTRVRGGW
FT                   VGEFPGLSRLDVEGNLLPTSDFRALYASVIEQWMGQDAAQVIPEAARFQRYALLR"
     MHRSCDEFTR ASAARSGRAT AGDGLPAIEP GMPLPAGTGM TRRSLLLGGA GLALTIFGGR        60
     ALAPQAFAEG LDAAAAAAPD APVIVSVFLS GGVDSIALLA PVEDPRYTRA LRPSLFVEPA       120
     ATLPASGTTA MRWHPSAAAF KELHDRGRLT VFPAIGYEHA NGSHFTSRHF YEVGATDPDS       180
     ATGWLGRYLD IVGEDHNPVQ GFTVGPTLSP SLASARVAVA AAEAPQAYDF VSPGIEGGPF       240
     KDELVRGHAA IGRLTSTDPV LGPARAMHRD AADLRAALSA PLPGTSVSYP AGRLGQRLRD       300
     VVRLLAAGLP IRCATVDATA DFDTHAGQRD TFTEQIAEAG AALAAFQADL ESRPGLADRV       360
     LTIAWSEFGR RPEENGSAGT DHGAGGVGFL LGTRVRGGWV GEFPGLSRLD VEGNLLPTSD       420
     FRALYASVIE QWMGQDAAQV IPEAARFQRY ALLR                                   454
//

If you have problems or comments...

PBIL Back to PBIL home page