(data stored in ACNUC7421 zone)

EMBL: CP001854.PE168

CP001854.PE168       Location/Qualifiers
FT   CDS             165183..166172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0168"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48604"
FT                   /db_xref="GOA:D3F526"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D3F526"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ADB48604.1"
FT                   /translation="MTSSDAPVKGYQLKDISPRAWQHPADRAATAALASVPYLDKVVRM
FT                   LIQLGYERALRQASLGASVRLGEQQLPDVWSDHVFAYSTLDIASTPPLYVMQTPEPNAF
FT                   AIGAKNPIVVVQSELLQLLDAPQRRAVFAHEAAHILADHQLYRTALLILLRLTAAARMP
FT                   LPLMPVRTALLEWYRATELSCDRAAALVTRDPLAVCRTLMSITAGTMVDELDLDAFMTQ
FT                   SMDYAERGNGIERLTRLLLDLGLTHPLPVRRTRELMLWVRSGEFDRIVGGDYVKRDDPV
FT                   SVRAESGEAVSFYSDRFKDAFRDAGETIGQGGQQLADWLRKAKDDIGS"
     MTSSDAPVKG YQLKDISPRA WQHPADRAAT AALASVPYLD KVVRMLIQLG YERALRQASL        60
     GASVRLGEQQ LPDVWSDHVF AYSTLDIAST PPLYVMQTPE PNAFAIGAKN PIVVVQSELL       120
     QLLDAPQRRA VFAHEAAHIL ADHQLYRTAL LILLRLTAAA RMPLPLMPVR TALLEWYRAT       180
     ELSCDRAAAL VTRDPLAVCR TLMSITAGTM VDELDLDAFM TQSMDYAERG NGIERLTRLL       240
     LDLGLTHPLP VRRTRELMLW VRSGEFDRIV GGDYVKRDDP VSVRAESGEA VSFYSDRFKD       300
     AFRDAGETIG QGGQQLADWL RKAKDDIGS                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page