(data stored in ACNUC7421 zone)

EMBL: CP001854.PE169

CP001854.PE169       Location/Qualifiers
FT   CDS             166235..167236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0169"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: dac:Daci_4435 oxidoreductase domain-
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48605"
FT                   /db_xref="GOA:D3F527"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D3F527"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ADB48605.1"
FT                   /translation="MGAATGEVIRLGIAGGGIMGERIAATVARLDGIEVRAIADANPAQ
FT                   RERLGQAFGCSAVATWEELVAGGEVDAVYVGLPNHLHAAAACAAAEAGLHVLIDKPLCE
FT                   TLAEGERILAAVERAGVRLMVGFSHRFHVELTTAKRMLAAGELGAPVLATDIIVDSAPD
FT                   GPDWYWDRAAGGGVVQLQMHHSFDRLAWLLDSPIVRVQASVHERALRGAEPADVAAAVT
FT                   LTFANGAVGTSAASFVTGYDGDGIVELAIQGTHGHVRIETWRSIEAQTARSAFDQHQRR
FT                   DDWLGAEVAEFAAAIRERREPSVTGRDGLRALRVALAAFESARTGRAVDITP"
     MGAATGEVIR LGIAGGGIMG ERIAATVARL DGIEVRAIAD ANPAQRERLG QAFGCSAVAT        60
     WEELVAGGEV DAVYVGLPNH LHAAAACAAA EAGLHVLIDK PLCETLAEGE RILAAVERAG       120
     VRLMVGFSHR FHVELTTAKR MLAAGELGAP VLATDIIVDS APDGPDWYWD RAAGGGVVQL       180
     QMHHSFDRLA WLLDSPIVRV QASVHERALR GAEPADVAAA VTLTFANGAV GTSAASFVTG       240
     YDGDGIVELA IQGTHGHVRI ETWRSIEAQT ARSAFDQHQR RDDWLGAEVA EFAAAIRERR       300
     EPSVTGRDGL RALRVALAAF ESARTGRAVD ITP                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page