(data stored in ACNUC7421 zone)

EMBL: CP001854.PE17

CP001854.PE17        Location/Qualifiers
FT   CDS             20542..22518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0017"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: Serine/threonine protein kinase-related;
FT                   tyrosine protein kinase; PASTA domain containing protein;
FT                   SMART: serine/threonine protein kinase; tyrosine protein
FT                   kinase; PASTA domain containing protein; KEGG: scl:sce2470
FT                   protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48453"
FT                   /db_xref="GOA:D3EYQ0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:D3EYQ0"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ADB48453.1"
FT                   /translation="MTEIAPDTVIDSRYKVLSRIGAGGMAEVFCAQDQSLGRKVALKLL
FT                   YERFASDAEFVERFRREASSAASLQHPNVVGIYDRGRWDGTYYIAMEYLPGRSLKEVIQ
FT                   QDAPIDHVRAIDLTIQILKAARFAHRRGIVHRDLKPHNVIVDDEDRAKVTDFGIARAGA
FT                   SDMTETGSIMGTAQYLSPEQAQGHAVSPQSDLYSVGVILFELLTGNVPFEAESAVTIAL
FT                   KHVSEPPPAPSAFDPSVPPELEAIVLWALEKDPAHRPQDADAFIQALEQARDQILGREA
FT                   PGQRTAMFAAGALAIPQADDGAPPAEEPPDAERSRRRPPWWAWVVAVLAVAGVVAAIVL
FT                   LTRPDQVAVPNVVGQQLQAATRRLERDGLEWRIENVNNDAEVGEVVDQSPRGRRRVEEG
FT                   TTVTLKVSRGPGTIDVPAVDGETVARATAILQNVGLTVGGTIDQNDASVPIGEVIRSSP
FT                   RAGENVERGSAVKLYVSTGPAQVAVPDVVGSTRDEAIATLTNAGFRYSTTEQESADADP
FT                   GDVISQDPGGGTDADPGSTLAIVIARAPPVEVPSVVGSGADDARAALEARGLVVRQSPV
FT                   DVTDPAQDGIVVDQRPAPGTSVADGAPVRIFVGRFVEPTTPPDGDGDDQGDNGDGGATD
FT                   PSDGDGNADQNGPVGRAQSRRPT"
     MTEIAPDTVI DSRYKVLSRI GAGGMAEVFC AQDQSLGRKV ALKLLYERFA SDAEFVERFR        60
     REASSAASLQ HPNVVGIYDR GRWDGTYYIA MEYLPGRSLK EVIQQDAPID HVRAIDLTIQ       120
     ILKAARFAHR RGIVHRDLKP HNVIVDDEDR AKVTDFGIAR AGASDMTETG SIMGTAQYLS       180
     PEQAQGHAVS PQSDLYSVGV ILFELLTGNV PFEAESAVTI ALKHVSEPPP APSAFDPSVP       240
     PELEAIVLWA LEKDPAHRPQ DADAFIQALE QARDQILGRE APGQRTAMFA AGALAIPQAD       300
     DGAPPAEEPP DAERSRRRPP WWAWVVAVLA VAGVVAAIVL LTRPDQVAVP NVVGQQLQAA       360
     TRRLERDGLE WRIENVNNDA EVGEVVDQSP RGRRRVEEGT TVTLKVSRGP GTIDVPAVDG       420
     ETVARATAIL QNVGLTVGGT IDQNDASVPI GEVIRSSPRA GENVERGSAV KLYVSTGPAQ       480
     VAVPDVVGST RDEAIATLTN AGFRYSTTEQ ESADADPGDV ISQDPGGGTD ADPGSTLAIV       540
     IARAPPVEVP SVVGSGADDA RAALEARGLV VRQSPVDVTD PAQDGIVVDQ RPAPGTSVAD       600
     GAPVRIFVGR FVEPTTPPDG DGDDQGDNGD GGATDPSDGD GNADQNGPVG RAQSRRPT         658
//

If you have problems or comments...

PBIL Back to PBIL home page