(data stored in ACNUC7421 zone)

EMBL: CP001854.PE170

CP001854.PE170       Location/Qualifiers
FT   CDS             complement(167254..168000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0170"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bgl:bglu_1g21360 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48606"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D3F528"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADB48606.1"
FT                   /translation="MFHTLTACPVAVHEVPTSKVFFGRDDDAIHALTFYVWIVRGPNGV
FT                   GLVDAGLPPHADDLAALRTTGVYRDVVPLADVLAQHALTPADVDWCCITQPVTYHSGGV
FT                   LPELLPHAQVYLSRAGMTELLCDPPGHPPTEFFFTARSWAYLRELAIDGRLHVVDEPTE
FT                   VVPGVVFETTGGHHPGSAGVRVQTADGLAGILETAFVQENVDAEIPVGIAEDVARCRRE
FT                   IKRWKQTCDVVLADHEPALAERYRGR"
     MFHTLTACPV AVHEVPTSKV FFGRDDDAIH ALTFYVWIVR GPNGVGLVDA GLPPHADDLA        60
     ALRTTGVYRD VVPLADVLAQ HALTPADVDW CCITQPVTYH SGGVLPELLP HAQVYLSRAG       120
     MTELLCDPPG HPPTEFFFTA RSWAYLRELA IDGRLHVVDE PTEVVPGVVF ETTGGHHPGS       180
     AGVRVQTADG LAGILETAFV QENVDAEIPV GIAEDVARCR REIKRWKQTC DVVLADHEPA       240
     LAERYRGR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page