(data stored in ACNUC7421 zone)

EMBL: CP001854.PE171

CP001854.PE171       Location/Qualifiers
FT   CDS             168198..169604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0171"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bxe:Bxe_B0080 ABC sugar transporter, periplasmic
FT                   ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48607"
FT                   /db_xref="UniProtKB/TrEMBL:D3F529"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADB48607.1"
FT                   /translation="MHDHQDADARERADAEQGLKVSRATLLRGAAAAGIALPAMGLLSA
FT                   CGSGDDDSSASTSGDSGGTSEAYTGALAMTAWEAYPDQIRENLAAFKQQYGNQVDLTLI
FT                   PNIGYGPAIQTRLQGGQEIDAYYNFAYNSTKFVDAGWAKELNDLPGVEEMLADMFETSA
FT                   ARHKLPDGRIVSVPYFSAVHLLMYNEAQLRENGISAAPQSYSEIYDQCEKLKAGGVRAP
FT                   YAAYWTKQFSEEYFILYLVSEGIVPFDDDGNPTFQDDPKTEGVLDWWTSMYQDGLTARS
FT                   ILTDDPGKHVAAMAQGTSSFFTLHHYFLKEIRNARGPQSRNVTMSYRIPGSSGESLQIG
FT                   EVVQMGTKADGGRADRAWELLKFYGWKDKDGRYGTFISWAESAALLGPYPGLFKDPQFR
FT                   RAFPAYYDLGELERAFEASQVVPARVLPWYSSFQTKVGDRIQAMLLGQASVKDTISSLA
FT                   DDAKSFAAAG"
     MHDHQDADAR ERADAEQGLK VSRATLLRGA AAAGIALPAM GLLSACGSGD DDSSASTSGD        60
     SGGTSEAYTG ALAMTAWEAY PDQIRENLAA FKQQYGNQVD LTLIPNIGYG PAIQTRLQGG       120
     QEIDAYYNFA YNSTKFVDAG WAKELNDLPG VEEMLADMFE TSAARHKLPD GRIVSVPYFS       180
     AVHLLMYNEA QLRENGISAA PQSYSEIYDQ CEKLKAGGVR APYAAYWTKQ FSEEYFILYL       240
     VSEGIVPFDD DGNPTFQDDP KTEGVLDWWT SMYQDGLTAR SILTDDPGKH VAAMAQGTSS       300
     FFTLHHYFLK EIRNARGPQS RNVTMSYRIP GSSGESLQIG EVVQMGTKAD GGRADRAWEL       360
     LKFYGWKDKD GRYGTFISWA ESAALLGPYP GLFKDPQFRR AFPAYYDLGE LERAFEASQV       420
     VPARVLPWYS SFQTKVGDRI QAMLLGQASV KDTISSLADD AKSFAAAG                    468
//

If you have problems or comments...

PBIL Back to PBIL home page