(data stored in ACNUC7421 zone)

EMBL: CP001854.PE172

CP001854.PE172       Location/Qualifiers
FT   CDS             169588..170562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0172"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: spe:Spro_2296
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48608"
FT                   /db_xref="GOA:D3F530"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F530"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48608.1"
FT                   /translation="MPPQADSTAAPRPPVRSQPARTRARRRSRRAAADRRFGLYLALPA
FT                   LIVVLGLIAWPAIQTLIYSLQRVALNGDTRWVGLRNFKLLIENPDFVHSLWLTAVYAIA
FT                   FLVVSTVLGLAFALLLNERFRGRWLARTLLIVPWACPWVIAGIIWKWFADGDVGALNGA
FT                   LYQIGVIDEYKAWLSSDTGALIISVLAAAWRQASFAALLFLAGLQTIPHELPEAAKVDG
FT                   ATAWQRFRLITLPWLKPVIVVVIVINVIFGFMQFDVIYALTQGGPGNATEVLSIFLYEQ
FT                   LFVYTNVGLGSATAVVLGVVALLIGLLFVKVIYRSDDVTKGVS"
     MPPQADSTAA PRPPVRSQPA RTRARRRSRR AAADRRFGLY LALPALIVVL GLIAWPAIQT        60
     LIYSLQRVAL NGDTRWVGLR NFKLLIENPD FVHSLWLTAV YAIAFLVVST VLGLAFALLL       120
     NERFRGRWLA RTLLIVPWAC PWVIAGIIWK WFADGDVGAL NGALYQIGVI DEYKAWLSSD       180
     TGALIISVLA AAWRQASFAA LLFLAGLQTI PHELPEAAKV DGATAWQRFR LITLPWLKPV       240
     IVVVIVINVI FGFMQFDVIY ALTQGGPGNA TEVLSIFLYE QLFVYTNVGL GSATAVVLGV       300
     VALLIGLLFV KVIYRSDDVT KGVS                                              324
//

If you have problems or comments...

PBIL Back to PBIL home page