(data stored in ACNUC7421 zone)

EMBL: CP001854.PE173

CP001854.PE173       Location/Qualifiers
FT   CDS             170559..171494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0173"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0078 ABC sugar
FT                   transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48609"
FT                   /db_xref="GOA:D3F531"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D3F531"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADB48609.1"
FT                   /translation="MSAVAMRERAASGRRRRSARRRPLRQFLIYVGVALFAIWVLFPLY
FT                   FTVTSSFMKPSEVGRVPYHWVPEEPTLKNYTAILKGDSTPFSDDAARGVSVSSTNAVER
FT                   LMPAMGRSVMVGLVVVFINLVVGGAAAYAFSRYPFRGAKIAYLGLLASRVVPAIAIVSP
FT                   FFVFFRKTELLNTAPALIISYLVFTLPLAIWLLKSYFDSVPKELEEAAMLDGASRLKCL
FT                   ISIVLPLARPGLIAAGLLVFLEAWSEFFYALVLTNELTAPPVVAGLQNLQQFSWTTLAA
FT                   ASIFSLIPPVLIAVVFQRYIVSGLARGSVR"
     MSAVAMRERA ASGRRRRSAR RRPLRQFLIY VGVALFAIWV LFPLYFTVTS SFMKPSEVGR        60
     VPYHWVPEEP TLKNYTAILK GDSTPFSDDA ARGVSVSSTN AVERLMPAMG RSVMVGLVVV       120
     FINLVVGGAA AYAFSRYPFR GAKIAYLGLL ASRVVPAIAI VSPFFVFFRK TELLNTAPAL       180
     IISYLVFTLP LAIWLLKSYF DSVPKELEEA AMLDGASRLK CLISIVLPLA RPGLIAAGLL       240
     VFLEAWSEFF YALVLTNELT APPVVAGLQN LQQFSWTTLA AASIFSLIPP VLIAVVFQRY       300
     IVSGLARGSV R                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page