(data stored in ACNUC7421 zone)

EMBL: CP001854.PE174

CP001854.PE174       Location/Qualifiers
FT   CDS             171491..172438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0174"
FT                   /product="aryldialkylphosphatase"
FT                   /note="PFAM: aryldialkylphosphatase; KEGG: kpu:KP1_2777
FT                   putative hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48610"
FT                   /db_xref="GOA:D3F532"
FT                   /db_xref="InterPro:IPR001559"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D3F532"
FT                   /inference="protein motif:PFAM:PF02126"
FT                   /protein_id="ADB48610.1"
FT                   /translation="MNSSERVMTVLGPIAPEQMGVTLSHDHLLVDGWGIRELYDAILDD
FT                   EELAVREAARYKAAGGGTICDPTNIGLARAPAALKRISERSGVHVVMGAGWYRERVYPD
FT                   YVLEEMPDQLADRLVTELVDGVDGTGVKPGFIGEIGTERHHVTPAQERVFRAAGRAHRR
FT                   TGVPIMTHTTHWGELAIEQLDLLAEEGVPAAAVIISHLGDRPGIRHWLPIAERGAWLDV
FT                   DNLAFIGGYAPLSVRADNVAGLCAEGLAGQVMLSNDICELGQLAFYDGCGYDNVIVNFL
FT                   PMLRERGVSEEDIHTMTVANPGKAFAWDLSRVGA"
     MNSSERVMTV LGPIAPEQMG VTLSHDHLLV DGWGIRELYD AILDDEELAV REAARYKAAG        60
     GGTICDPTNI GLARAPAALK RISERSGVHV VMGAGWYRER VYPDYVLEEM PDQLADRLVT       120
     ELVDGVDGTG VKPGFIGEIG TERHHVTPAQ ERVFRAAGRA HRRTGVPIMT HTTHWGELAI       180
     EQLDLLAEEG VPAAAVIISH LGDRPGIRHW LPIAERGAWL DVDNLAFIGG YAPLSVRADN       240
     VAGLCAEGLA GQVMLSNDIC ELGQLAFYDG CGYDNVIVNF LPMLRERGVS EEDIHTMTVA       300
     NPGKAFAWDL SRVGA                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page