(data stored in ACNUC7421 zone)

EMBL: CP001854.PE175

CP001854.PE175       Location/Qualifiers
FT   CDS             172435..173670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Cwoe_0175"
FT                   /product="Pyridoxal phosphate-dependent transferase"
FT                   /note="PFAM: Pyridoxal phosphate-dependent transferase;
FT                   aminotransferase class V; Cys/Met metabolism pyridoxal-
FT                   phosphate-dependent protein; KEGG: mlo:mlr3804
FT                   selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Cwoe_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ADB48611"
FT                   /db_xref="GOA:D3F533"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:D3F533"
FT                   /inference="protein motif:PFAM:PF03841"
FT                   /protein_id="ADB48611.1"
FT                   /translation="MTALLDSLGVRPLINAVGPATRLGSSTPSADVLAAMAEAAAVYLP
FT                   MHELQRAAGAEIAALTGAEAGYVTNGAAAGLMLAAAACIAGDDPALMNRLPFTDGMRDE
FT                   IVVHRGQRIAYDHAVRASGARLVEIGFHDLTFPYELDAAIGERTAAVLYFSNSGANALP
FT                   LEQVVAIAHARGVPVILDASLAIPPVENLRRFADLGVDLVAVSGGKWIGGPAASGFLYG
FT                   RADLLRSVALQQQDQDVRVETWHGAPLIAGGTVAGPPHQGIGRALKVGKEEIAGLLAAL
FT                   RAYVARDHAADQARWRAAAQTVVDALAGIPGADARVLPADGRERGWPIAEIALDEPALG
FT                   LGAYDVVRALAAGAPPIALDEAVAWRGALRVTPTHLRDGEAAVVAAALAAALRRTDPTS
FT                   AHTKADRKDTDA"
     MTALLDSLGV RPLINAVGPA TRLGSSTPSA DVLAAMAEAA AVYLPMHELQ RAAGAEIAAL        60
     TGAEAGYVTN GAAAGLMLAA AACIAGDDPA LMNRLPFTDG MRDEIVVHRG QRIAYDHAVR       120
     ASGARLVEIG FHDLTFPYEL DAAIGERTAA VLYFSNSGAN ALPLEQVVAI AHARGVPVIL       180
     DASLAIPPVE NLRRFADLGV DLVAVSGGKW IGGPAASGFL YGRADLLRSV ALQQQDQDVR       240
     VETWHGAPLI AGGTVAGPPH QGIGRALKVG KEEIAGLLAA LRAYVARDHA ADQARWRAAA       300
     QTVVDALAGI PGADARVLPA DGRERGWPIA EIALDEPALG LGAYDVVRAL AAGAPPIALD       360
     EAVAWRGALR VTPTHLRDGE AAVVAAALAA ALRRTDPTSA HTKADRKDTD A                411
//

If you have problems or comments...

PBIL Back to PBIL home page